PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 238aa    MW: 26852.3 Da    PI: 8.7522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013413.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.2e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l++++++ G g+W+t ++  g+ R++k+c++rw +yl
      Pbr013413.1 13 KGAWSKQEDLKLIEYIRKNGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60
                     79******************************99************97 PP

2Myb_DNA-binding52.21.4e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Pbr013413.1  66 RGNFAEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111
                      8999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-22463IPR009057Homeodomain-like
PROSITE profilePS5129416.07860IPR017930Myb domain
SuperFamilySSF466892.18E-2711107IPR009057Homeodomain-like
SMARTSM007173.5E-121262IPR001005SANT/Myb domain
PfamPF002491.8E-141360IPR001005SANT/Myb domain
CDDcd001672.17E-91560No hitNo description
PROSITE profilePS5129426.90661115IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2664115IPR009057Homeodomain-like
SMARTSM007171.0E-1565113IPR001005SANT/Myb domain
PfamPF002493.7E-1566111IPR001005SANT/Myb domain
CDDcd001673.05E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MRKPCCDKQD TNKGAWSKQE DLKLIEYIRK NGEGCWRTLP QAAGLLRCGK SCRLRWINYL  60
RPDLKRGNFA EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLMNMGI  120
DPNNHRPNNV NLPRLHHQNS QTVSSTATLS AALKNPTNYQ LQARSGGNNN CDHESDGTSC  180
LEDDSCGRLP DLNLDLTITA PLSNPVPDNL KEEQNFESKV SKKSSEFASS TILPLFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28101154108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ1268570.0KJ126857.1 Malus hybrid cultivar MYB2 (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009357784.11e-176PREDICTED: myb-related protein 308-like
SwissprotQ9SZP13e-77MYB4_ARATH; Transcription repressor MYB4
TrEMBLX2GGE61e-173X2GGE6_9R
STRINGVIT_01s0011g04760.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-78myb domain protein 4